PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_26079_BGI-A2_v1.0
Common NameF383_09897
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 160aa    MW: 17917.1 Da    PI: 10.0116
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_26079_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1063.2e-3365121158
                   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                 +ep++VNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+RgsgGrF
  Cotton_A_26079_BGI-A2_v1.0  65 EEPVFVNAKQYHGILRRRQSRAKAESENKL-AKSRKPYLHESRHLHALRRARGSGGRF 121
                                 69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.4E-3663124IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.03964124IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.2E-2866121IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.6E-246789IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068606989IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.6E-2498121IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MPYTTPQHAV APAAYPYPDP YYRSIFAPYD AQSYPPQPYG GQPMVHLQLM GIQQAGVPLP  60
SDAVEEPVFV NAKQYHGILR RRQSRAKAES ENKLAKSRKP YLHESRHLHA LRRARGSGGR  120
FLNSKKNENK QNEAAPSDKS QSNINLNSDK NELASTEGKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-2264129166NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4227751e-62AM422775.1 Antirrhinum majus mRNA for YA6 (nf-YA gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443085.11e-116PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443084.11e-116PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443083.11e-116PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443082.11e-116PREDICTED: nuclear transcription factor Y subunit A-7-like
SwissprotQ84JP14e-66NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A0B0NSG01e-116A0A0B0NSG0_G
STRINGVIT_10s0003g04650.t014e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.24e-53nuclear factor Y, subunit A7